PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo29G0024800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 341aa    MW: 38573 Da    PI: 10.0509
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo29G0024800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.58.5e-15453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd ll  +v+q+G++ W+++a++m+    R +k+c +rw +yl
  Spipo29G0024800  4 RQRWKPEEDALLRAYVRQYGPREWNLVAQRMNapFSRDAKSCLERWKNYL 53
                     89********************************99************97 PP

2Myb_DNA-binding36.41.2e-1159103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  Spipo29G0024800  59 KGSLTEEEQRLVIRLQAKHGNK-WKKIAAEIP-GRTAKRLGKWWEVF 103
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.962157IPR017930Myb domain
SMARTSM007178.3E-14355IPR001005SANT/Myb domain
SuperFamilySSF466896.39E-22498IPR009057Homeodomain-like
CDDcd001671.03E-8653No hitNo description
Gene3DG3DSA:1.10.10.601.3E-21660IPR009057Homeodomain-like
PfamPF139215.3E-14768No hitNo description
SMARTSM007174.6E-1058106IPR001005SANT/Myb domain
PROSITE profilePS5129418.65958108IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-1561102IPR009057Homeodomain-like
CDDcd001673.97E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MKERQRWKPE EDALLRAYVR QYGPREWNLV AQRMNAPFSR DAKSCLERWK NYLKPGIKKG  60
SLTEEEQRLV IRLQAKHGNK WKKIAAEIPG RTAKRLGKWW EVFKEKQQRE LKDSAAAAAI  120
THPIDHAKYD QILENFAEKL VKDRQAAPFL MPSSPILPPW LSTSSSSSSP SSSSSPTSIA  180
PPPPPPSVTL TLSPSALTPP PAPWRQPERP AESSNGAANP GGVGSVVSEL AECCRELEEG  240
HRALAAHKKE AAWRLRRVEL QLESEKACKR REKMEEIEGK IRALREQQTA ALERIEAEYR  300
EQLAGLRQDA EAKEQKLAEQ WAAKYGRLTQ FLEQLGCLPR P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-16792789MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-16792789C-Myb DNA-Binding Domain
1msf_C2e-16792789C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010922322.11e-170PREDICTED: transcription factor AS1-like
RefseqXP_010922323.11e-170PREDICTED: transcription factor AS1-like
RefseqXP_010922324.11e-170PREDICTED: transcription factor AS1-like
RefseqXP_010922325.11e-170PREDICTED: transcription factor AS1-like
SwissprotO809311e-151AS1_ARATH; Transcription factor AS1
TrEMBLA0A061ER461e-164A0A061ER46_THECC; Myb-like HTH transcriptional regulator family protein isoform 1
STRINGVIT_08s0007g00410.t011e-161(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51903654
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.12e-78MYB family protein